Human Insulin (INS), Recombinant Protein
Invented at International Centre For Genetic Engineering And Biotechnology (ICGEB)
- Datasheet
- References (0)
- Inventor Info
Info
| Catalogue Number | 153804 |
| Amino Acid Sequence | B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT A chain: GIVEQCCTSICSLYQLENYCN |
| Cellular/Tissue Localisation | Beta cells of Pancreatic Islets |
| Source | Produced in Pichia pastoris |
| Storage | -20 |
| Synonyms | Insulin, INS |
| Relevance |
Two-chain polypeptide hormone produced by the β-cells of pancreatic islets. The α and β chains are joined by two interchain disulfide bonds. The α chain contains an intrachain disulfide bond. Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat. Serum-free medium supplements such as insulin are essential for long-term growth of commonly used mammalian cell lines. When insulin is absent from media, cell may exhibit disturbances in morphology and growth rate. |
| Notes |
Human recombinant insulin is identical in function and structure to the native human sequence. A hormone consisting of two polypeptide chains, Insulin′s A-chain (21 amino acids) and B-chain (30 amino acids) are covalently linked by disulfide bonds between cysteine residues. Molecular Weight: ~5.8 kDa UniProt number P01308 |
| Research Area | Cell Signaling & Signal Transduction, Metabolism |
References
There are 0 reference entries for this reagent.
References: 0 entry
There is no reference for this reagent yet, feel free to use the button below to suggest one.
Add a reference
References: 0 entry
There is no reference for this reagent yet, feel free to use the button below to suggest one.
Add a reference
