Cancer Research Technology
Log in Register
Menu

Human Insulin (INS), Recombinant Protein

Info

Catalogue Number 153804
Amino Acid Sequence B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT A chain: GIVEQCCTSICSLYQLENYCN
Cellular/Tissue Localisation Beta cells of Pancreatic Islets
Source Produced in Pichia pastoris
Storage -20
Synonyms Insulin, INS
Relevance Two-chain polypeptide hormone produced by the β-cells of pancreatic islets. The α and β chains are joined by two interchain disulfide bonds. The α chain contains an intrachain disulfide bond. Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat.
Serum-free medium supplements such as insulin are essential for long-term growth of commonly used mammalian cell lines. When insulin is absent from media, cell may exhibit disturbances in morphology and growth rate.
Notes Human recombinant insulin is identical in function and structure to the native human sequence. A hormone consisting of two polypeptide chains, Insulin′s A-chain (21 amino acids) and B-chain (30 amino acids) are covalently linked by disulfide bonds between cysteine residues.
Molecular Weight: ~5.8 kDa
UniProt number P01308
Research Area Cell Signaling & Signal Transduction, Metabolism

References

There are 0 reference entries for this reagent.

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference

Inventor Information