Cancer Research Technology
Log in Register
Menu

Human Interferon alpha 2A

Info

Catalogue Number 153800
Amino Acid Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Cellular/Tissue Localisation B cells, Cancer cells, NK cells, T cells
Source Produced in Escherichia coli
Storage -20
Synonyms Human IFN alpha 2A, IFN-alpha 2, IFNA2, IFNA2a
Relevance Interferon-alpha (IFN-α) is a type I interferon, produced by virus-infected cells, and is released as a soluble factor to initiate antiviral responses. IFN-α2 is the most potent IFN-α used in fundamental research and in most clinical applications. The best-known IFN-α2 subvariants, 2A and 2B, differ by only one or two amino acids at positions 23 and/or 34 of the mature protein. Type I IFNs exert potent antitumor activity by increasing the cytotoxic activity of NK and T cells, as well as by inhibiting the proliferation of cancer cells. Additionally, it has been shown that proinflammatory IFN-α modulates the function of B cells in patients with systemic lupus erythematosus, and pegylated forms of IFN-alpha 2A and 2B have implications in the treatment of hepatitis C.
Notes Molecular Weight: 19.4 kDa
UniProt number P01563 (Lys at position 23)
Research Area Cancer, Immunology

References

There are 0 reference entries for this reagent.

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference

Inventor Information