Log in Register
Menu

Anti-NR0B1 [3DA-3E5]

Info

Applications ELISA IHC IF WB
Antigen/Gene or Protein Targets  DAX-1(NROB1) 
Reactivity N/A
Relevance DAX‐1 (NR0B1) is an unusual orphan member of the nuclear hormone receptor family. Duplications in Xp21, containing the DAX‐1 gene, cause phenotypic sex reversal in XY individuals (DSS), while DAX‐1 gene mutations are responsible for adrenal hypoplasia congenita (AHC), invariably associated with hypogonadotropic hypogonadism (HHG). DAX‐1 functions as a negative regulator of steroid hormone production by repressing the expression of multiple genes involved in the steroidogenic pathway.
Host Mouse
Immunogen (C)VSEPSMLQKILTTRRRETGGNEPLPVPTLQ
Subclass IgG1 kappa
Notes Available in 100ul unit as ascites.
Research Area Epigenetics & Nuclear Signalling

References: 2 entries

Lehmann et al. 2002. Proc Natl Acad Sci U S A. 99(12):8225-30. PMID: 12034880.

Zanaria et al. 1994. Nature. 372(6507):635-41. PMID: 7990953.


Add a reference

References: 2 entries

Lehmann et al. 2002. Proc Natl Acad Sci U S A. 99(12):8225-30. PMID: 12034880.

Zanaria et al. 1994. Nature. 372(6507):635-41. PMID: 7990953.


Add a reference

References: 2 entries

Lehmann et al. 2002. Proc Natl Acad Sci U S A. 99(12):8225-30. PMID: 12034880.

Zanaria et al. 1994. Nature. 372(6507):635-41. PMID: 7990953.


Add a reference


This reagent does not have any reviews at the moment.