Cancer Research Technology
Log in Register
Menu

Human Erythropoietin alpha (EpoA), Recombinant Protein
RECENTLY UPDATED

Info

Catalogue Number 153802
Amino Acid Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD
Cellular/Tissue Localisation Hematopoietic stem and Progenitor cells, Mesoderm, PSC-Derived, Pluripotent stem cells
Source Produced in Chinese Hamster Ovary Cells
Storage -20
Synonyms Epoetin, Erythropoietin, EP
Relevance Erythropoietin (EPO) is a glycoprotein growth factor that is produced primarily in the kidney in response to hypoxia or anemia. It is the principal physiological regulator of erythropoiesis. EPO promotes erythropoiesis by binding to a homodimeric cell surface receptor that activates JAK2/STAT5, PI3K/AKT, and MAPK pathways, and stimulates the proliferation and differentiation of erythroid progenitor cells.
Notes Molecular Weight: 18.4 kDa
UniProt number P01588
Research Area Stem Cell Biology

References

There are 0 reference entries for this reagent.

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference

Inventor Information