Human Erythropoietin alpha (EpoA), Recombinant Protein
Invented at International Centre For Genetic Engineering And Biotechnology (ICGEB)
- Datasheet
- References (0)
- Inventor Info
Info
| Catalogue Number | 153802 |
| Amino Acid Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Cellular/Tissue Localisation | Hematopoietic stem and Progenitor cells, Mesoderm, PSC-Derived, Pluripotent stem cells |
| Source | Produced in Chinese Hamster Ovary Cells |
| Storage | -20 |
| Synonyms | Epoetin, Erythropoietin, EP |
| Relevance | Erythropoietin (EPO) is a glycoprotein growth factor that is produced primarily in the kidney in response to hypoxia or anemia. It is the principal physiological regulator of erythropoiesis. EPO promotes erythropoiesis by binding to a homodimeric cell surface receptor that activates JAK2/STAT5, PI3K/AKT, and MAPK pathways, and stimulates the proliferation and differentiation of erythroid progenitor cells. |
| Notes |
Molecular Weight: 18.4 kDa UniProt number P01588 |
| Research Area | Stem Cell Biology |
References
There are 0 reference entries for this reagent.
References: 0 entry
There is no reference for this reagent yet, feel free to use the button below to suggest one.
Add a reference
References: 0 entry
There is no reference for this reagent yet, feel free to use the button below to suggest one.
Add a reference
