Cancer Research Technology
Log in Register

Anti-Integrin α-3B [54B3] monoclonal Antibody

Invented by Prof Arnoud Sonnenberg at Netherlands Cancer Institute


Catalogue Number 154744
Applications IHC WB
Antigen/Gene or Protein Targets Integrin α3B
Synonyms ITGA3; Antigen CD61
Reactivity Human
Relevance ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the α3β1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.
Host Mouse
Immunogen A mouse was immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin α3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Subclass IgG1
Myeloma Used Sp2/0-Ag14
Recommended Growing Conditions RPMI +10% FBS ultra low IgG, 37 ⁰C 5% CO2
Strain Balb/c
Notes Fusion partners: SP2/0 x spleen cells origin BALB/C. Recognizes specifically the cytoplasmic domain of integrin subunit α3B which is present in microvascular structures in brain and heart.
Research Area Adhesion, Cell Signaling & Signal Transduction


There are 1 reference entries for this reagent.

View All References

References: 1 entry

de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.

Add a reference

References: 1 entry

de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.

Add a reference