Cancer Research Technology
Log in Register
Menu

Anti-Integrin α-3A [29A3] monoclonal Antibody
NEW

Invented by Prof Arnoud Sonnenberg at Netherlands Cancer Institute

Info

Catalogue Number 154742
Applications IHC WB
Antigen/Gene or Protein Targets Integrin α3A
Synonyms ITGA3; Antigen CD49C
Reactivity Human
Relevance ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the α3β1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.
Host Mouse
Immunogen A mouse was immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Subclass IgG1
Myeloma Used Sp2/0-Ag14
Recommended Growing Conditions IMDM + 1% ZAP, 37 ⁰C 5% CO2
Strain Balb/c
Notes Fusion partners: SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse. Recognizes specifically the cytoplasmic domain of integrin subunit α3A which is present in the basal cell layer in skin, glomeruli, Bowman’s capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
Research Area Adhesion, Cell Signaling & Signal Transduction

References

There are 2 reference entries for this reagent.

View All References

References: 2 entries

de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.

Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.


Add a reference

References: 2 entries

de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.

Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.


Add a reference