Anti-Integrin α-3A [29A3] monoclonal Antibody
Invented by Prof Arnoud Sonnenberg from Netherlands Cancer Institute
Invented at Netherlands Cancer Institute
- Datasheet
- References (2)
- Inventor Info
Info
| Catalogue Number | 154742 |
| Applications | IHC WB |
| Antigen/Gene or Protein Targets | Integrin α3A |
| Synonyms | ITGA3; Antigen CD49C |
| Reactivity | Human |
| Relevance | ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the α3β1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin. |
| Host | Mouse |
| Immunogen | A mouse was immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. |
| Subclass | IgG1 |
| Myeloma Used | Sp2/0-Ag14 |
| Recommended Growing Conditions | IMDM + 1% ZAP, 37 ⁰C 5% CO2 |
| Strain | Balb/c |
| Notes | Fusion partners: SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse. Recognizes specifically the cytoplasmic domain of integrin subunit α3A which is present in the basal cell layer in skin, glomeruli, Bowman’s capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. |
| Research Area | Adhesion, Cell Signaling & Signal Transduction |
References: 2 entries
de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.
Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.
Add a reference
References: 2 entries
de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.
Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.
Add a reference