Cancer Research Technology
Log in Register

Anti-Integrin α-3A [158A3] monoclonal Antibody

Invented by Prof Arnoud Sonnenberg at Netherlands Cancer Institute


Catalogue Number 154739
Applications IHC WB
Antigen/Gene or Protein Targets Integrin α3A
Synonyms ITGA3; Antigen CD49C
Reactivity Dog and Human
Relevance ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the α3β1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.
Host Mouse
Immunogen A mouse was immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Subclass IgG2a
Myeloma Used Sp2/0-Ag14
Recommended Growing Conditions RPMI +10% FBS ultra low IgG, 37 ⁰C 5% CO2
Strain Balb/c
Notes Fusion partners: SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse. Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit α3A
Research Area Adhesion, Cell Signaling & Signal Transduction


There are 2 reference entries for this reagent.

View All References

References: 2 entries

de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.

Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.

Add a reference

References: 2 entries

de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.

Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.

Add a reference