Anti-Integrin α-3A [158A3] monoclonal Antibody
Invented by Prof Arnoud Sonnenberg from Netherlands Cancer Institute
Invented at Netherlands Cancer Institute
- Datasheet
- References (2)
- Inventor Info
Info
| Catalogue Number | 154739 |
| Applications | IHC WB |
| Antigen/Gene or Protein Targets | Integrin α3A |
| Synonyms | ITGA3; Antigen CD49C |
| Reactivity | Dog and Human |
| Relevance | ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the α3β1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin. |
| Host | Mouse |
| Immunogen | A mouse was immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. |
| Subclass | IgG2a |
| Myeloma Used | Sp2/0-Ag14 |
| Recommended Growing Conditions | RPMI +10% FBS ultra low IgG, 37 ⁰C 5% CO2 |
| Strain | Balb/c |
| Notes | Fusion partners: SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse. Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit α3A |
| Research Area | Adhesion, Cell Signaling & Signal Transduction |
References: 2 entries
de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.
Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.
Add a reference
References: 2 entries
de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.
Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.
Add a reference