Cancer Research Technology
Log in Register
Menu

Human Erythropoietin beta (EpoB), Recombinant Protein
RECENTLY UPDATED

Invented at International Centre For Genetic Engineering And Biotechnology (ICGEB)

Info

Catalogue Number 153803
Amino Acid Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD
Cellular/Tissue Localisation Hematopoietic Stem and Progenitor Cells, Mesoderm, PSC-Derived, Pluripotent Stem Cells
Source Produced in Chinese Hamster Ovary Cells
Storage -20
Synonyms Epoetin, Erythropoietin, EP
Relevance Erythropoietin (EPO) is a glycoprotein growth factor that is produced primarily in the kidney in response to hypoxia or anemia. It is the principal physiological regulator of erythropoiesis. EPO promotes erythropoiesis by binding to a homodimeric cell surface receptor that activates JAK2/STAT5, PI3K/AKT, and MAPK pathways, and stimulates the proliferation and differentiation of erythroid progenitor cells.
Notes Molecular Weight: 18.4 kDa
UniProt number P01588
Research Area Stem Cell Biology

References

There are 0 reference entries for this reagent.

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference

Inventor Information

No inventors are currently linked to this reagent.

Add an inventor