Human Granulocyte Colony-Stimulating Factor (GCSF), Recombinant Protein
Invented at International Centre For Genetic Engineering And Biotechnology (ICGEB)
- Datasheet
- References (0)
- Inventor Info
Info
| Catalogue Number | 153801 |
| Amino Acid Sequence | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Cellular/Tissue Localisation | Hematopoietic Stem and Progenitor cells, Neurons, Cancer cells, Mesoderm, PSC-Derived |
| Source | Produced in Escherichia coli |
| Storage | +4 |
| Synonyms | Human Granulocyte colony-stimulating factor, Colony-stimulating factor 3, CSF-3, MGI-1G, Pluripoietin |
| Relevance | Granulocyte colony-stimulating factor (G-CSF) is a member of the CSF family of glycoproteins that regulate hematopoietic cell proliferation, differentiation, and function. It is a key cytokine involved in the production of neutrophils and the stimulation of granulocyte colony formation from hematopoietic progenitor cells. G-CSF causes a range of effects including a transient reduction of SDF-1 expression, the activation of metalloproteases that cleave VCAM-1, and the release of norepinephrine from the sympathetic nervous system, leading to the release or mobilization of hematopoietic stem cells from the bone marrow into the periphery. The G-CSF receptor is expressed on a variety of hematopoietic cells, including myeloid-committed progenitor cells, neutrophils, granulocytes, and monocytes. In addition to hematopoietic cells, G-CSF is also expressed in cardiomyocytes, neuronal cells, mesothelial cells, and endothelial cells. Binding of G-CSF to its receptor leads to activation of the JAK/STAT, MAPK, PI3K, and AKT signal transduction pathways. |
| Notes |
Molecular Weight: 18.8 kDa UniProt number P09919-2 (Met at the N-terminus) |
| Research Area | Neurobiology, Stem Cell Biology |
References
There are 0 reference entries for this reagent.
References: 0 entry
There is no reference for this reagent yet, feel free to use the button below to suggest one.
Add a reference
References: 0 entry
There is no reference for this reagent yet, feel free to use the button below to suggest one.
Add a reference