Cancer Research Technology
Log in Register

Anti-Growth Differentiation Factor 9 [53/1]

Invented at


Catalogue Number 153651
Applications ELISA IHC WB
Antigen/Gene or Protein Targets Growth Differentiation Factor 9
Synonyms Growth/differentiation factor 9, GDF-9, GDF9
Reactivity Human
Relevance GDF9 is plays a vital role in ovarian folliculogenesis, follicle development and fertility. Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
Host Mouse
Immunogen Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
Positive Control Ovary
Subclass IgG1
Molecular Weight (kDa) 17.5
Myeloma Used Sp2/0-Ag14
Strain Balb/c
Notes Suggested dilutions for use

Western Blot 1:100-1:1000
Immunohistochemistry 1:25-1:100
ELISA Assay-dependent

Research Areas: Endocrinology;Cancer;Fertility
Research Area Cancer


There are 10 reference entries for this reagent.

View All References

References: 10 entries

Li et al. 2015. Mol Endocrinol. 29(1):40-52. PMID: 25394262.

Modifications of human growth differentiation factor 9 to improve the generation of embryos from low competence oocytes.

Europe PMC ID: 25394262

Simpson et al. 2014. J Clin Endocrinol Metab. 99(4):E615-24. PMID: 24438375.

Aberrant GDF9 expression and activation are associated with common human ovarian disorders.

Europe PMC ID: 24438375

Simpson et al. 2012. Endocrinology. 153(3):1301-10. PMID: 22234469.

Activation of latent human GDF9 by a single residue change (Gly 391 Arg) in the mature domain.

Europe PMC ID: 22234469

Mottershead et al. 2008. Mol Cell Endocrinol. 283(1-2):58-67. PMID: 18162287.

Characterization of recombinant human growth differentiation factor-9 signaling in ovarian granulosa cells.

Europe PMC ID: 18162287

Gilchrist et al. 2004. Biol Reprod. 71(3):732-9. PMID: 15128595.

Immunoneutralization of growth differentiation factor 9 reveals it partially accounts for mouse oocyte mitogenic activity.

Europe PMC ID: 15128595

Add a reference

References: 10 entries

Li et al. 2015. Mol Endocrinol. 29(1):40-52. PMID: 25394262.

Modifications of human growth differentiation factor 9 to improve the generation of embryos from low competence oocytes.

Simpson et al. 2014. J Clin Endocrinol Metab. 99(4):E615-24. PMID: 24438375.

Aberrant GDF9 expression and activation are associated with common human ovarian disorders.

Simpson et al. 2012. Endocrinology. 153(3):1301-10. PMID: 22234469.

Activation of latent human GDF9 by a single residue change (Gly 391 Arg) in the mature domain.

Mottershead et al. 2008. Mol Cell Endocrinol. 283(1-2):58-67. PMID: 18162287.

Characterization of recombinant human growth differentiation factor-9 signaling in ovarian granulosa cells.

Gilchrist et al. 2004. Biol Reprod. 71(3):732-9. PMID: 15128595.

Immunoneutralization of growth differentiation factor 9 reveals it partially accounts for mouse oocyte mitogenic activity.

Add a reference

Inventor Information

No inventors are currently linked to this reagent.

Add an inventor

Invented at