Anti-Growth Differentiation Factor 9 [53/1]

Invented at

Datasheet

References (10)

Inventor Info

Info

Image thumbnail for Anti-Growth Differentiation Factor 9 [53/1]

Add an image

Biological neutralizing capacity of 53/1 by ELISA. Biological neutralizing specificity of anti-GDF9-53 with some members of the TGFβ superfamily. Mouse MGC were cultured with human TGFβ1 (0.5 ng/ml), human activin A (50 ng/ml), or mouse GDF9 (40 ng/ml), either in the absence or presence of a high neutralizing dose of 40 μg/ml of mAb-GDF9-53 or 40 μg/ml human IgG. Source: Gilchrist et al. 2004. Biol Reprod. 71(3):732-9. PMID: 15128595.

Clone 53/1 used to detect GDF9 expression by ELISA. GDF9 ELISA. A GDF9 ELISA was developed to measure the amount of GDF9 in HEK-293T conditioned medium. Recombinant mouse GDF9 (●) was used as a standard, and the specificity of the assay was assessed using a range of TGF-β family members; wild-type human GDF9 (♦), human GDF9 L40V (◊), human BMP15 (□), human activin A (○), and human TGF-β3 (▾). Dilutions of concentrated media from cells transfected with empty vector, pcDNA3.1 (r), were included as controls. The ELISA has a specificity of less than 0.1%, with a sensitivity of 0.2 ng/mL. Values represent mean ± SEM in duplicate, from a representative experiment. Source: Simpson et al. 2014. J Clin Endocrinol Metab. 99(4):E615-24. PMID: 24438375.

Clone 53/1 used to detect GDF9 expression in oocyte-medium via western blot. GDF9 immunoblot analysis. A) Antibody specificity for GDF9 and (B) detection of oocyte-secreted GDF9. The recombinant proteins indicated (mGDF9 = mouse GDF9, oBMP15 = ovine BMP15) and oocyte extract or oocyte-conditioned medium were subjected to SDS-PAGE immunoblotting with the anti-GDF9 monoclonal antibody and detected using either ECL (A; recombinant proteins) or ECL Advance (B; oocyte products). The 57-kDa band is the GDF9 proprotein while the 17.5-kDa band represents the mature GDF9 monomer. 293H = control; conditioned medium from the untransfected human embryonic kidney 293H parent cell line. Source: Gilchrist et al. 2004. Biol Reprod. 71(3):732-9. PMID: 15128595.

Clone 53/1 used to detect GDF9 expression in oocyte-medium by western blot. ... Samples were detected under reducing conditions using GDF9 mAb53 specific for the mature domain. The 60-kDa GDF9 precursor and 20-kDa mature monomer are shown. Source: Simpson et al. 2014. J Clin Endocrinol Metab. 99(4):E615-24. PMID: 24438375.

Add an image

Catalogue Number	153651
Applications	ELISA IHC WB
Antigen/Gene or Protein Targets	Growth Differentiation Factor 9
Synonyms	Growth/differentiation factor 9, GDF-9, GDF9
Reactivity	Human
Relevance	GDF9 is plays a vital role in ovarian folliculogenesis, follicle development and fertility. Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
Host	Mouse
Immunogen	Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
Positive Control	Ovary
Subclass	IgG1
Molecular Weight (kDa)	17.5
Myeloma Used	Sp2/0-Ag14
Strain	Balb/c
Notes	Suggested dilutions for use Western Blot 1:100-1:1000 Immunohistochemistry 1:25-1:100 ELISA Assay-dependent Research Areas: Endocrinology;Cancer;Fertility
Research Area	Cancer

References

There are 10 reference entries for this reagent.

View All References

References: 10 entries

Li et al. 2015. Mol Endocrinol. 29(1):40-52. PMID: 25394262.

View

Modifications of human growth differentiation factor 9 to improve the generation of embryos from low competence oocytes.

Europe PMC ID: 25394262

View

Simpson et al. 2014. J Clin Endocrinol Metab. 99(4):E615-24. PMID: 24438375.

View

Aberrant GDF9 expression and activation are associated with common human ovarian disorders.

Europe PMC ID: 24438375

View

Simpson et al. 2012. Endocrinology. 153(3):1301-10. PMID: 22234469.

View

Activation of latent human GDF9 by a single residue change (Gly 391 Arg) in the mature domain.

Europe PMC ID: 22234469

View

Mottershead et al. 2008. Mol Cell Endocrinol. 283(1-2):58-67. PMID: 18162287.

View

Characterization of recombinant human growth differentiation factor-9 signaling in ovarian granulosa cells.

Europe PMC ID: 18162287

View

Gilchrist et al. 2004. Biol Reprod. 71(3):732-9. PMID: 15128595.

View

Immunoneutralization of growth differentiation factor 9 reveals it partially accounts for mouse oocyte mitogenic activity.

Europe PMC ID: 15128595

View

Add a reference

References: 10 entries

Li et al. 2015. Mol Endocrinol. 29(1):40-52. PMID: 25394262.

View

Modifications of human growth differentiation factor 9 to improve the generation of embryos from low competence oocytes.

View

Simpson et al. 2014. J Clin Endocrinol Metab. 99(4):E615-24. PMID: 24438375.

View

Aberrant GDF9 expression and activation are associated with common human ovarian disorders.

View

Simpson et al. 2012. Endocrinology. 153(3):1301-10. PMID: 22234469.

View

Activation of latent human GDF9 by a single residue change (Gly 391 Arg) in the mature domain.

View

Mottershead et al. 2008. Mol Cell Endocrinol. 283(1-2):58-67. PMID: 18162287.

View

Characterization of recombinant human growth differentiation factor-9 signaling in ovarian granulosa cells.

View

Gilchrist et al. 2004. Biol Reprod. 71(3):732-9. PMID: 15128595.

View

Immunoneutralization of growth differentiation factor 9 reveals it partially accounts for mouse oocyte mitogenic activity.

View

Add a reference

Inventor Information

No inventors are currently linked to this reagent.

Add an inventor

Invented at

OBTAIN THIS REAGENT

This reagent can be obtained from the following supplier. Click through to their website for more details.

Anti-Growth Differentiation Factor 9 [53/1]

Invented at

Info

References

References: 10 entries

References: 10 entries

Inventor Information

Invented at

How we use cookies