Anti-Activin C [BetaC1]
Invented at
- Datasheet
- References (6)
- Inventor Info
Info
![Image thumbnail for Anti-Activin C [BetaC1]](https://res.cloudinary.com/ximbio/image/upload/c_fit,fl_lossy,h_45,q_auto/b3afd6b8-3bd8-4750-8407-2d5c27b2d0df.png)
![Image thumbnail for Anti-Activin C [BetaC1]](https://res.cloudinary.com/ximbio/image/upload/c_fit,fl_lossy,h_45,q_auto/d79bc5f2-e292-4e3c-bb7b-dc49f36062ea.png)
![Image thumbnail for Anti-Activin C [BetaC1]](https://res.cloudinary.com/ximbio/image/upload/c_fit,fl_lossy,h_45,q_auto/31f99e7e-8ad1-4bbb-96c9-396c0b30ad83.png)
| Catalogue Number | 153637 |
| Applications | IHC WB |
| Antigen/Gene or Protein Targets | Activin C |
| Synonyms | Activin beta-C chain, Inhibin beta C chain |
| Reactivity | Human |
| Relevance | Activin is part of the TGF-beta superfamily, known to regulate growth and differentiation of cells. The β-C subunit of Activin is expressed in a range of tissues having growth promoting and inhibitory properties. β-C Clone 1 recognizes the β-C subunit of Activin and is a useful stain to detect expression of the protein in hepatocyte cells. |
| Host | Mouse |
| Immunogen | Synthetic peptide sequence VPTARRPLSLLYYDRDSNIKVTDIPMVVEAC which recognizes amino acids 82-113 of human Activin β -C subunit |
| Positive Control | Liver |
| Subclass | IgG1 |
| Myeloma Used | Sp2/0-Ag14 |
| Strain | Balb/c |
| Notes |
Suggested dilutions for use Western Blot 1:3000-1:5000 Immunohistochemistry 5.0-5.8 μg/mL Research Areas: Endocrinology;Cancer;Immunology;Hepatology |
| Research Area | Cancer, Immunology |
References: 6 entries
Gold et al. 2005. J Mol Endocrinol. 34(2):505-15. PMID: 15821113.
betaA- and betaC-activin, follistatin, activin receptor mRNA and betaC-activin peptide expression during rat liver regeneration.
Europe PMC ID: 15821113
Mellor et al. 2003. Endocrinology. 144(10):4410-9. PMID: 12960042.
Activin betaC-subunit heterodimers provide a new mechanism of regulating activin levels in the prostate.
Europe PMC ID: 12960042
Mellor et al. 2000. J Clin Endocrinol Metab. 85(12):4851-8. PMID: 11134153.
Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.
Europe PMC ID: 11134153
Add a reference
References: 6 entries
Gold et al. 2005. J Mol Endocrinol. 34(2):505-15. PMID: 15821113.
betaA- and betaC-activin, follistatin, activin receptor mRNA and betaC-activin peptide expression during rat liver regeneration.
Mellor et al. 2003. Endocrinology. 144(10):4410-9. PMID: 12960042.
Activin betaC-subunit heterodimers provide a new mechanism of regulating activin levels in the prostate.
Mellor et al. 2000. J Clin Endocrinol Metab. 85(12):4851-8. PMID: 11134153.
Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.
Add a reference