Cancer Research Technology
Log in Register

Anti-Activin C [BetaC1]

Invented at


Catalogue Number 153637
Applications IHC WB
Antigen/Gene or Protein Targets Activin C
Synonyms Activin beta-C chain, Inhibin beta C chain
Reactivity Human
Relevance Activin is part of the TGF-beta superfamily, known to regulate growth and differentiation of cells. The β-C subunit of Activin is expressed in a range of tissues having growth promoting and inhibitory properties. β-C Clone 1 recognizes the β-C subunit of Activin and is a useful stain to detect expression of the protein in hepatocyte cells.
Host Mouse
Immunogen Synthetic peptide sequence VPTARRPLSLLYYDRDSNIKVTDIPMVVEAC which recognizes amino acids 82-113 of human Activin β -C subunit
Positive Control Liver
Subclass IgG1
Myeloma Used Sp2/0-Ag14
Strain Balb/c
Notes Suggested dilutions for use

Western Blot 1:3000-1:5000
Immunohistochemistry 5.0-5.8 μg/mL

Research Areas: Endocrinology;Cancer;Immunology;Hepatology
Research Area Cancer, Immunology


There are 6 reference entries for this reagent.

View All References

References: 6 entries

Gold et al. 2005. J Mol Endocrinol. 34(2):505-15. PMID: 15821113.

betaA- and betaC-activin, follistatin, activin receptor mRNA and betaC-activin peptide expression during rat liver regeneration.

Europe PMC ID: 15821113

Mellor et al. 2003. Endocrinology. 144(10):4410-9. PMID: 12960042.

Activin betaC-subunit heterodimers provide a new mechanism of regulating activin levels in the prostate.

Europe PMC ID: 12960042

Mellor et al. 2000. J Clin Endocrinol Metab. 85(12):4851-8. PMID: 11134153.

Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.

Europe PMC ID: 11134153

Add a reference

References: 6 entries

Gold et al. 2005. J Mol Endocrinol. 34(2):505-15. PMID: 15821113.

betaA- and betaC-activin, follistatin, activin receptor mRNA and betaC-activin peptide expression during rat liver regeneration.

Mellor et al. 2003. Endocrinology. 144(10):4410-9. PMID: 12960042.

Activin betaC-subunit heterodimers provide a new mechanism of regulating activin levels in the prostate.

Mellor et al. 2000. J Clin Endocrinol Metab. 85(12):4851-8. PMID: 11134153.

Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.

Add a reference

Inventor Information

No inventors are currently linked to this reagent.

Add an inventor

Invented at