Cat. #153801
Human Granulocyte Colony-Stimulating Factor (GCSF), Recombinant Protein
Cat. #: 153801
Sub-type: Cytokine
Availability: Please enquire for quantities and pricing
This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.
Contributor
Inventor: Natasa Skoko
Institute: International Centre For Genetic Engineering And Biotechnology (ICGEB)
Tool Details
*FOR RESEARCH USE ONLY
- Tool name: Human Granulocyte Colony-Stimulating Factor (GCSF), Recombinant Protein
- Alternate name: Human Granulocyte colony-stimulating factor, Colony-stimulating factor 3, CSF-3, MGI-1G, Pluripoietin
- Tool sub type: Cytokine
- Sequence: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
- Cellular tissue localisation: Hematopoietic Stem and Progenitor cells, Neurons, Cancer cells, Mesoderm, PSC-Derived
- Source: Produced in Escherichia coli
- Description: Granulocyte colony-stimulating factor (G-CSF) is a member of the CSF family of glycoproteins that regulate hematopoietic cell proliferation, differentiation, and function. It is a key cytokine involved in the production of neutrophils and the stimulation of granulocyte colony formation from hematopoietic progenitor cells. G-CSF causes a range of effects including a transient reduction of SDF-1 expression, the activation of metalloproteases that cleave VCAM-1, and the release of norepinephrine from the sympathetic nervous system, leading to the release or mobilization of hematopoietic stem cells from the bone marrow into the periphery. The G-CSF receptor is expressed on a variety of hematopoietic cells, including myeloid-committed progenitor cells, neutrophils, granulocytes, and monocytes. In addition to hematopoietic cells, G-CSF is also expressed in cardiomyocytes, neuronal cells, mesothelial cells, and endothelial cells. Binding of G-CSF to its receptor leads to activation of the JAK/STAT, MAPK, PI3K, and AKT signal transduction pathways.
- Molecular weight: 18.8 kDa
- Expression system: Recombinant
- Uniprot id: P09919-2
- Additional notes: Met at the N-terminus
Handling
- Storage conditions: 4° C
- Shipping conditions: Dry Ice
Application Details
- Application notes: Molecular Weight: 18.8 kDa UniProt number P09919-2 (Met at the N-terminus)