Cat. #153800
Human Interferon alpha 2A
Cat. #: 153800
Sub-type: Cytokine
Availability: Please enquire for quantities and pricing
This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.
Contributor
Inventor: Natasa Skoko
Institute: International Centre For Genetic Engineering And Biotechnology (ICGEB)
Tool Details
*FOR RESEARCH USE ONLY
- Tool name: Human Interferon alpha 2A
- Alternate name: Human IFN alpha 2A, IFN-alpha 2, IFNA2, IFNA2a
- Research fields: Cancer;Immunology
- Tool sub type: Cytokine
- Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
- Cellular tissue localisation: B cells, Cancer cells, NK cells, T cells
- Source: E.coli
- Description: Interferon-alpha (IFN-a) is a type I interferon, produced by virus-infected cells, and is released as a soluble factor to initiate antiviral responses. IFN-a2 is the most potent IFN-a used in fundamental research and in most clinical applications. The best-known IFN-a2 subvariants, 2A and 2B, differ by only one or two amino acids at positions 23 and/or 34 of the mature protein. Type I IFNs exert potent antitumor activity by increasing the cytotoxic activity of NK and T cells, as well as by inhibiting the proliferation of cancer cells. Additionally, it has been shown that proinflammatory IFN-a modulates the function of B cells in patients with systemic lupus erythematosus, and pegylated forms of IFN-alpha 2A and 2B have implications in the treatment of hepatitis C.
- Molecular weight: 19.4 kDa
- Uniprot id: P01563
- Additional notes: Lys at position 23
Handling
- Storage conditions: -20° C
- Shipping conditions: Dry Ice
Application Details
- Application notes: Molecular Weight: 19.4 kDa UniProt number P01563 (Lys at position 23)