Cancer Research Technology
Log in Register
Menu

Human Recombinant GCSF

Info

Catalogue Number 153801
Amino Acid Sequence MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Cellular/Tissue Localisation Hematopoietic Stem and Progenitor cells, Neurons, Cancer cells, Mesoderm, PSC-Derived
Source Produced in Escherichia coli
Storage +4
Synonyms Human Granulocyte colony-stimulating factor, Colony-stimulating factor 3, CSF-3, MGI-1G, Pluripoietin
Relevance Granulocyte colony-stimulating factor (G-CSF) is a member of the CSF family of glycoproteins that regulate hematopoietic cell proliferation, differentiation, and function. It is a key cytokine involved in the production of neutrophils and the stimulation of granulocyte colony formation from hematopoietic progenitor cells. G-CSF causes a range of effects including a transient reduction of SDF-1 expression, the activation of metalloproteases that cleave VCAM-1, and the release of norepinephrine from the sympathetic nervous system, leading to the release or mobilization of hematopoietic stem cells from the bone marrow into the periphery. The G-CSF receptor is expressed on a variety of hematopoietic cells, including myeloid-committed progenitor cells, neutrophils, granulocytes, and monocytes. In addition to hematopoietic cells, G-CSF is also expressed in cardiomyocytes, neuronal cells, mesothelial cells, and endothelial cells. Binding of G-CSF to its receptor leads to activation of the JAK/STAT, MAPK, PI3K, and AKT signal transduction pathways.
Notes Molecular Weight: 18.8 kDa
UniProt number P09919-2 (Met at the N-terminus)
Research Area Neurobiology, Stem Cell Biology

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference

References: 0 entry

There is no reference for this reagent yet, feel free to use the button below to suggest one.

Add a reference


This reagent does not have any reviews at the moment.